Beefy Boxes and Bandwidth Generously Provided by pair Networks
P is for Practical
 
PerlMonks  

comment on

( #3333=superdoc: print w/replies, xml ) Need Help??
hi all, i need a small clarification in the following program. i have a datafile like this.
ENTRY CCHU #type complete TITLE cytochrome c [validated] - human Homo sapiens ORGANISM #formal_name Homo sapiens #common_name man ACCESSIONS A31764; A05676; I55192; A00001 MGDVEKGKKIFIMKCSQCHTVEMGDVEKGGKHKTGPNLHGMIYARAJLFGRKTSEKGQAPGYSYTAANKN +KGIIWGEDTLMEYLENPKKYIP ENTRY CCCZ #type complete TITLE cytochrome c - chimpanzee (tentative sequence) ORGANISM #formal_name Pan troglodytes #common_name chimpanzee ACCESSIONS A00002 GDVEKGKKIFIMKCSQCHTSEKVEKGSSSKHKSSSTGPNLHGLMIYARAJFGRKTGSEKQAPGYSYTAAN +KNKGIIWGED ENTRY CCMQR #type complete TITLE cytochrome c - rhesus macaque (tentative sequence) Macaca mulatta ORGANISM #formal_name Macaca mulatta #common_name rhesus macaq +ue ACCESSIONS A00003 GDVEKGKKIFIMKCSQSEKCHTVEKGGSSSSKHKTGPNLHGSSEKEMIYARAJKSEKLFGAAAAAAAARK +TGQAPGYSYTAANKSSSSNKGITWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEE ENTRY CCMKP #type complete TITLE cytochrome c - spider monkey ORGANISM #formal_name Ateles sp. #common_name spider monkey ACCESSIONS A00004 GDVFKGKRIFIMKCSQCHTVESSSSKGGKHKTGPNLHGLMIYARAJSEKFGSSSSSSSSSSR
i have written a program to save each and every line in a seperate array. this is the program
open (PIR,'/home/guest/sampir.txt'); my @arr = (); while (<PIR>) { chomp; if( /^ENTRY/ ) { $entry = $_ } elsif ( /^(TITLE)\s+(\S.*)/ ) { $title = "$1\n\t $2" } elsif ( /^(ORGANISM)\s+(\S.*)/ ) { $org = "$1\n\t $2" } elsif ( /^ACCESSIONS/ ) { $acc = $_ } else { push @se, $_; } }
but the line which is under the TITLE heading is not giving the 2nd line of its data. instead it gives only the first line. eg; when i print the title of the first entry it prints only "cytochrome c validated - human "and its not printing the second line "Homo sapiens"... How do i print the second line too in the same first line? plz help out. thanks.

In reply to doubt in storing a data of 2 lines in an array. by heidi

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post; it's "PerlMonks-approved HTML":



  • Are you posting in the right place? Check out Where do I post X? to know for sure.
  • Posts may use any of the Perl Monks Approved HTML tags. Currently these include the following:
    <code> <a> <b> <big> <blockquote> <br /> <dd> <dl> <dt> <em> <font> <h1> <h2> <h3> <h4> <h5> <h6> <hr /> <i> <li> <nbsp> <ol> <p> <small> <strike> <strong> <sub> <sup> <table> <td> <th> <tr> <tt> <u> <ul>
  • Snippets of code should be wrapped in <code> tags not <pre> tags. In fact, <pre> tags should generally be avoided. If they must be used, extreme care should be taken to ensure that their contents do not have long lines (<70 chars), in order to prevent horizontal scrolling (and possible janitor intervention).
  • Want more info? How to link or How to display code and escape characters are good places to start.
Log In?
Username:
Password:

What's my password?
Create A New User
Domain Nodelet?
Chatterbox?
and the web crawler heard nothing...

How do I use this? | Other CB clients
Other Users?
Others chilling in the Monastery: (5)
As of 2023-09-30 11:43 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?

    No recent polls found

    Notices?