Beefy Boxes and Bandwidth Generously Provided by pair Networks
Syntactic Confectionery Delight
 
PerlMonks  

comment on

( [id://3333]=superdoc: print w/replies, xml ) Need Help??

Take the spaces out of $letters and you should get

$prot_object = bless( { 'primary_seq' => bless( { 'length' => 63, '_root_verbose' => 0 +, '_nowarnonempty' => +undef, 'seq' => 'MGPTSQPTLH +PQNHAGIGLRKGKHLCVAYEPFLYLLLSQQGRKREEAAVERIRLREVGISLL*', 'alphabet' => 'prote +in' }, 'Bio::PrimarySeq' ) +, '_root_verbose' => 0 }, 'Bio::Seq' );

whatever that means !

poj

In reply to Re^3: REGEX help by poj
in thread REGEX help by Mike98mm

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post; it's "PerlMonks-approved HTML":



  • Are you posting in the right place? Check out Where do I post X? to know for sure.
  • Posts may use any of the Perl Monks Approved HTML tags. Currently these include the following:
    <code> <a> <b> <big> <blockquote> <br /> <dd> <dl> <dt> <em> <font> <h1> <h2> <h3> <h4> <h5> <h6> <hr /> <i> <li> <nbsp> <ol> <p> <small> <strike> <strong> <sub> <sup> <table> <td> <th> <tr> <tt> <u> <ul>
  • Snippets of code should be wrapped in <code> tags not <pre> tags. In fact, <pre> tags should generally be avoided. If they must be used, extreme care should be taken to ensure that their contents do not have long lines (<70 chars), in order to prevent horizontal scrolling (and possible janitor intervention).
  • Want more info? How to link or How to display code and escape characters are good places to start.
Log In?
Username:
Password:

What's my password?
Create A New User
Domain Nodelet?
Chatterbox?
and the web crawler heard nothing...

How do I use this?Last hourOther CB clients
Other Users?
Others meditating upon the Monastery: (2)
As of 2024-04-25 18:58 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?

    No recent polls found