Re: what's "plots are not rendered as ASCII art" ?

The chart (black picture) that is just above the text "Download PostScript file" is an interactive Java applet; notice that numbers in the legend (upper-right corner) change as you move your cursor across the chart.

Perhaps you could configure that applet to run locally, to achieve the same result after downloading the page? I am not sure what you intend, and this problem is not caused by Perl; you would get the same result with `wget` or `curl`.

Alternately, you could download the (non-interactive) chart as Encapsulated PostScript, and view it without an applet (although you will need the free Win32 Postscript programs GhostScript and GhostView.
This code works for me:

use strict;
use warnings;
use LWP;
my $base_url = 'http://dis.embl.de';
my $protein = 'MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGE
+RLTSI';
my $browser = LWP::UserAgent->new;
$browser->env_proxy();
my $response = $browser->post(
  "$base_url/cgiDict.py", # That's the URL that the real form submits 
+to.
  [
    key             => 'process',
    SP_entry        => '',
    sequence_string => $protein,
    smooth_frame    => '8',
    peak_frame      => '8',
    join_frame      => '4',
    fold_coils      => '1.20',
    fold_rem465     => '1.20',
    fold_hotloops   => '1.40',
    plot_title      => '',
    doApplet        => 'true',
    tango_PH        => 7.40,
    tango_T         => 298.15,
    tango_I         => 0.02,
    tango_TFE       => 0.00,
    fold_tango      => 1.00,
  ] 
);
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 

my $html = $response->content;
my ($eps) = ( $html =~ m{<a href="([^"]+)">Download PostScript file</a
+>} )
  or die;

$response = $browser->get("$base_url/$eps");
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 

my $out_path = 'tmp.eps';
open my $out_fh, '>', $out_path
  or die "Can't write-open out_file: $!";
print {$out_fh} $response->content;
close $out_fh;
system( 'C:/Program Files/Ghostgum/gsview/gsview32.exe', $out_path );
[download]

Comment on Re: what's "plots are not rendered as ASCII art" ? Download Code

Replies are listed 'Best First'.
Re^2: what's "plots are not rendered as ASCII art" ? by genbank (Novice) on Apr 15, 2011 at 05:09 UTC
Yeah, it's not a simple picture. This script you provided is so great. However I want to show the webpage normally including the "black chart". what about the script as following? use strict; use LWP; my $protein = "MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGE +RLTSI"; my $browser = LWP::UserAgent->new; $browser->env_proxy(); my $response = $browser->post( 'http://dis.embl.de/cgiDict.py', # That's the URL that the real form submits to. [ 'key' => "process", 'SP_entry' => "", 'sequence_string' => $protein, 'smooth_frame' => "8", 'peak_frame' => "8", 'join_frame' => "4", 'fold_coils' => "1.20", 'fold_rem465' => "1.20", 'fold_hotloops' => "1.40", 'plot_title' => "", 'doApplet' => "true", 'tango_PH' => "7.40", 'tango_T' => "298.15", 'tango_I' => "0.02", 'tango_TFE' => "0.00", 'fold_tango' => "1.00", ] ); die "Error: ", $response->status_line, "\n" unless $response->is_success; open(FILE, '>D:\perl\tmp2.html') \|\| die "Can't write-open out_file: $! +"; my $dat=$response->content; $dat=~s/"\//"http:\/\/dis.embl.de\//g; print FILE $dat; close FILE; system('C:\Program Files\Internet Explorer\IEXPLORE.EXE','D:\per +l\tmp2.html'); [download] This script can make the "black chart" correctly show up at the tmp2.html. The difference between the two script I post is "$dat=~s/"\//"http:\/\/dis.embl.de\//g;". But I don't know what's the function of "$dat=~s/"\//"http:\/\/dis.embl.de\//g;". Could you give me a explanation? Thanks a lot!	[reply] [d/l]
Re^3: what's "plots are not rendered as ASCII art" ? by Eliya (Vicar) on Apr 15, 2011 at 08:47 UTC
But I don't know what's the function of `"$dat=~s/"\//"http:\/\/dis.embl.de\//g;"` It substitutes `"/` with `"http://dis.embl.de/`, which presumably has the effect that IE will fetch URIs affected by the substitution remotely instead of trying to load them from your local disk (where `tmp2.html` resides). For example: `my $dat = '<img src="/foo.jpg">'; $dat=~s/"\//"http:\/\/dis.embl.de\//g; print $dat; # <img src="http://dis.embl.de/foo.jpg">` [download]	[reply] [d/l] [select]
Re^4: what's "plots are not rendered as ASCII art" ? by genbank (Novice) on Apr 15, 2011 at 11:50 UTC
Wow, thank you very much! I have understood. Thanks again!	[reply]


Welcome to the Monastery
	PerlMonks