comment on

davorg's reply suggested one way to approach the problem would be to read the whole file into memory then parse with regular expressions. The following script shows one possible way of doing this using two stages, the first to break into records and the second to break each record into fields. Here it is

use strict;
use warnings;

my $rxRecord = qr
   {(?xs)
       (ENTRY.*?\n)
       (?=ENTRY|\z)
   };

my $rxFieldHdrs = qr{(?:ENTRY|TITLE|ORGANISM|ACCESSIONS)};
my $rxField = qr
   {(?xs)
       ($rxFieldHdrs.*?\n)
       (?=$rxFieldHdrs|\z)
   };

my $fileText;
{
    local $/;
    $fileText = <DATA>;
}

my @records = $fileText =~ m{$rxRecord}g;

foreach my $record (@records)
{
    print qq{$record}, q{+} x 50, qq{\n};
    my @fields = $record =~ m{$rxField}g;
    foreach my $field (@fields)
    {
        print qq{$field}, q{-} x 50, qq{\n};
    }
    print q{*} x 50, qq{\n};
}

__END__
ENTRY            CCHU       #type complete
TITLE            cytochrome c [validated] - human
                 Homo sapiens
ORGANISM         #formal_name Homo sapiens #common_name man
ACCESSIONS       A31764; A05676; I55192; A00001
MGDVEKGKKIFIMKCSQCHTVEMGDVEKGGKHKTGPNLHGMIYARAJLFGRKTSEKGQAPGYSYTAANKN
+KGIIWGEDTLMEYLENPKKYIP
ENTRY            CCCZ       #type complete
TITLE            cytochrome c - chimpanzee (tentative sequence)
ORGANISM         #formal_name Pan troglodytes #common_name chimpanzee
ACCESSIONS       A00002
GDVEKGKKIFIMKCSQCHTSEKVEKGSSSKHKSSSTGPNLHGLMIYARAJFGRKTGSEKQAPGYSYTAAN
+KNKGIIWGED
ENTRY            CCMQR      #type complete
TITLE            cytochrome c - rhesus macaque (tentative sequence)
                 Macaca mulatta 
ORGANISM         #formal_name Macaca mulatta #common_name rhesus macaq
+ue
ACCESSIONS       A00003
GDVEKGKKIFIMKCSQSEKCHTVEKGGSSSSKHKTGPNLHGSSEKEMIYARAJKSEKLFGAAAAAAAARK
+TGQAPGYSYTAANKSSSSNKGITWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEE
ENTRY            CCMKP      #type complete
TITLE            cytochrome c - spider monkey
ORGANISM         #formal_name Ateles sp. #common_name spider monkey
ACCESSIONS       A00004
GDVFKGKRIFIMKCSQCHTVESSSSKGGKHKTGPNLHGLMIYARAJSEKFGSSSSSSSSSSR
[download]

and here is the output showing for each record the whole record then each individual field. As you can see, your two-line title is preserved.

ENTRY            CCHU       #type complete
TITLE            cytochrome c [validated] - human
                 Homo sapiens
ORGANISM         #formal_name Homo sapiens #common_name man
ACCESSIONS       A31764; A05676; I55192; A00001
MGDVEKGKKIFIMKCSQCHTVEMGDVEKGGKHKTGPNLHGMIYARAJLFGRKTSEKGQAPGYSYTAANKN
+KGIIWGEDTLMEYLENPKKYIP
++++++++++++++++++++++++++++++++++++++++++++++++++
ENTRY            CCHU       #type complete
--------------------------------------------------
TITLE            cytochrome c [validated] - human
                 Homo sapiens
--------------------------------------------------
ORGANISM         #formal_name Homo sapiens #common_name man
--------------------------------------------------
ACCESSIONS       A31764; A05676; I55192; A00001
MGDVEKGKKIFIMKCSQCHTVEMGDVEKGGKHKTGPNLHGMIYARAJLFGRKTSEKGQAPGYSYTAANKN
+KGIIWGEDTLMEYLENPKKYIP
--------------------------------------------------
**************************************************
ENTRY            CCCZ       #type complete
TITLE            cytochrome c - chimpanzee (tentative sequence)
ORGANISM         #formal_name Pan troglodytes #common_name chimpanzee
ACCESSIONS       A00002
GDVEKGKKIFIMKCSQCHTSEKVEKGSSSKHKSSSTGPNLHGLMIYARAJFGRKTGSEKQAPGYSYTAAN
+KNKGIIWGED
++++++++++++++++++++++++++++++++++++++++++++++++++
ENTRY            CCCZ       #type complete
--------------------------------------------------
TITLE            cytochrome c - chimpanzee (tentative sequence)
--------------------------------------------------
ORGANISM         #formal_name Pan troglodytes #common_name chimpanzee
--------------------------------------------------
ACCESSIONS       A00002
GDVEKGKKIFIMKCSQCHTSEKVEKGSSSKHKSSSTGPNLHGLMIYARAJFGRKTGSEKQAPGYSYTAAN
+KNKGIIWGED
--------------------------------------------------
**************************************************
ENTRY            CCMQR      #type complete
TITLE            cytochrome c - rhesus macaque (tentative sequence)
                 Macaca mulatta 
ORGANISM         #formal_name Macaca mulatta #common_name rhesus macaq
+ue
ACCESSIONS       A00003
GDVEKGKKIFIMKCSQSEKCHTVEKGGSSSSKHKTGPNLHGSSEKEMIYARAJKSEKLFGAAAAAAAARK
+TGQAPGYSYTAANKSSSSNKGITWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEE
++++++++++++++++++++++++++++++++++++++++++++++++++
ENTRY            CCMQR      #type complete
--------------------------------------------------
TITLE            cytochrome c - rhesus macaque (tentative sequence)
                 Macaca mulatta 
--------------------------------------------------
ORGANISM         #formal_name Macaca mulatta #common_name rhesus macaq
+ue
--------------------------------------------------
ACCESSIONS       A00003
GDVEKGKKIFIMKCSQSEKCHTVEKGGSSSSKHKTGPNLHGSSEKEMIYARAJKSEKLFGAAAAAAAARK
+TGQAPGYSYTAANKSSSSNKGITWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEE
--------------------------------------------------
**************************************************
ENTRY            CCMKP      #type complete
TITLE            cytochrome c - spider monkey
ORGANISM         #formal_name Ateles sp. #common_name spider monkey
ACCESSIONS       A00004
GDVFKGKRIFIMKCSQCHTVESSSSKGGKHKTGPNLHGLMIYARAJSEKFGSSSSSSSSSSR
++++++++++++++++++++++++++++++++++++++++++++++++++
ENTRY            CCMKP      #type complete
--------------------------------------------------
TITLE            cytochrome c - spider monkey
--------------------------------------------------
ORGANISM         #formal_name Ateles sp. #common_name spider monkey
--------------------------------------------------
ACCESSIONS       A00004
GDVFKGKRIFIMKCSQCHTVESSSSKGGKHKTGPNLHGLMIYARAJSEKFGSSSSSSSSSSR
--------------------------------------------------
**************************************************
[download]

I hope this is of use

Cheers,

JohnGG

In reply to Re: doubt in storing a data of 2 lines in an array. by johngg
in thread doubt in storing a data of 2 lines in an array. by heidi

Are you posting in the right place? Check out Where do I post X? to know for sure.
Posts may use any of the Perl Monks Approved HTML tags. Currently these include the following:
<code> <a> <b> <big> <blockquote> <br /> <dd> <dl> <dt> <em> <font> <h1> <h2> <h3> <h4> <h5> <h6> <hr /> <i> <li> <nbsp> <ol> <p> <small> <strike> <strong> <sub> <sup> <table> <td> <th> <tr> <tt> <u> <ul>
Snippets of code should be wrapped in <code> tags not <pre> tags. In fact, <pre> tags should generally be avoided. If they must be used, extreme care should be taken to ensure that their contents do not have long lines (<70 chars), in order to prevent horizontal scrolling (and possible janitor intervention).
Want more info? How to link or How to display code and escape characters are good places to start.


Keep It Simple, Stupid
	PerlMonks