heidi has asked for the wisdom of the Perl Monks concerning the following question:
hi all,
I have a sequence like this :
I want to cleave this sequence at the regions of "K" (or) "R" but they should not be present before "P". when i split it with either K or R, the K and R alphabet disappears. So, how do i split and also retain the alphabet? Finally, the list of fragments should be stored in an array. pls help. thanks :)APADPKGSTIDRPDAARTLTVHKCEQTDTRGVKEGTRNEDPQAECKPVSDVEFTITKLNVD
Back to
Seekers of Perl Wisdom